Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451 |
Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (4 families) Pfam PF00581 the active site structure is similar to those of the families I and II protein phosphatases; the topology can be related by a different circular permutation to the family I topology |
Family c.46.1.2: Multidomain sulfurtransferase (rhodanese) [52827] (4 proteins) duplication: consists of two domains of this fold |
Protein Sulfurtransferase [52830] (2 species) |
Species Azotobacter vinelandii [TaxId:354] [52831] (3 PDB entries) |
Domain d1e0ca2: 1e0c A:136-271 [32718] complexed with edo, mo6, so4 |
PDB Entry: 1e0c (more details), 1.8 Å
SCOP Domain Sequences for d1e0ca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e0ca2 c.46.1.2 (A:136-271) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} ggpvalslhdeptasrdyllgrlgaadlaiwdarspqeyrgekvlaakgghipgavnfew taamdpsralrirtdiagrleelgitpdkeivthcqthhrsgltyliakalgyprvkgya gswgewgnhpdtpvel
Timeline for d1e0ca2: