SCOP 1.73: Domain d1e0ca2: 1e0c A:136-271

Lineage for d1e0ca2 (1e0c A:136-271)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451

4. Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (4 families)
   Pfam PF00581
   the active site structure is similar to those of the families I and II protein phosphatases; the topology can be related by a different circular permutation to the family I topology

5. Family c.46.1.2: Multidomain sulfurtransferase (rhodanese) [52827] (4 proteins)
   duplication: consists of two domains of this fold

6. Protein Sulfurtransferase [52830] (2 species)

7. Species Azotobacter vinelandii [TaxId:354] [52831] (3 PDB entries)

8. Domain d1e0ca2: 1e0c A:136-271 [32718]
   complexed with edo, mo6, so4

Details for d1e0ca2

PDB Entry: 1e0c, 1.8 Å

PDB Description: sulfurtransferase from azotobacter vinelandii

PDB Compounds: (A:) sulfurtransferase

SCOP Domain Sequences for d1e0ca2:

Sequence; same for both SEQRES and ATOM records:

>d1e0ca2 c.46.1.2 (A:136-271) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]}
ggpvalslhdeptasrdyllgrlgaadlaiwdarspqeyrgekvlaakgghipgavnfew
taamdpsralrirtdiagrleelgitpdkeivthcqthhrsgltyliakalgyprvkgya
gswgewgnhpdtpvel

Timeline for d1e0ca2:

• d1e0ca2 first appeared (with stable ids) in SCOP 1.55
  
• d1e0ca2 appears in SCOP 1.71
  
• d1e0ca2 appears in SCOP 1.75
  
• d1e0ca2 appears in the current release, SCOPe 2.08