Lineage for d1ycsb1 (1ycs B:327-456)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 880274Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 880275Superfamily d.211.1: Ankyrin repeat [48403] (1 family) (S)
    repeats organized in elongated structures
  5. 880276Family d.211.1.1: Ankyrin repeat [48404] (17 proteins)
    this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain
  6. 880290Protein 53BP2 [48405] (1 species)
  7. 880291Species Human (Homo sapiens) [TaxId:9606] [48406] (1 PDB entry)
  8. 880292Domain d1ycsb1: 1ycs B:327-456 [19155]
    Other proteins in same PDB: d1ycsa_, d1ycsb2
    complexed with zn

Details for d1ycsb1

PDB Entry: 1ycs (more details), 2.2 Å

PDB Description: p53-53bp2 complex
PDB Compounds: (B:) 53bp2

SCOP Domain Sequences for d1ycsb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]}
plallldsslegefdlvqriiyevddpslpndegitalhnavcaghteivkflvqfgvnv
naadsdgwtplhcaascnnvqvckflvesgaavfamtysdmqtaadkceemeegytqcsq
flygvqekmg

SCOP Domain Coordinates for d1ycsb1:

Click to download the PDB-style file with coordinates for d1ycsb1.
(The format of our PDB-style files is described here.)

Timeline for d1ycsb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ycsb2
View in 3D
Domains from other chains:
(mouse over for more information)
d1ycsa_