Lineage for d2pgda1 (2pgd A:177-473)
- Root: SCOP 1.75
Class a: All alpha proteins [46456] (284 folds) 
Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetrySuperfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (12 families) 
N-terminal domain is Rossmann-fold with a family-specific C-terminal extensionFamily a.100.1.1: Hydroxyisobutyrate and 6-phosphogluconate dehydrogenase domain [48180] (2 proteins)
Hydroxyisobutyrate dehydrogenase domain is similar to one structural repeat in the 6-phosphogluconate dehydrogenase domain
Protein 6-phosphogluconate dehydrogenase (6PGD) [48181] (2 species)
duplication; contains two structural repeatsSpecies Sheep (Ovis orientalis aries) [TaxId:9940] [48182] (5 PDB entries) 
Domain d2pgda1: 2pgd A:177-473 [18778]
Other proteins in same PDB: d2pgda2
complexed with so4
Details for d2pgda1
PDB Entry: 2pgd (more details), 2 Å
PDB Description: the structure of 6-phosphogluconate dehydrogenase refined at 2 angstroms resolution
PDB Compounds: (A:) 6-phosphogluconate dehydrogenaseSCOP Domain Sequences for d2pgda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pgda1 a.100.1.1 (A:177-473) 6-phosphogluconate dehydrogenase (6PGD) {Sheep (Ovis orientalis aries) [TaxId: 9940]}
gaghfvkmvhngieygdmqliceayhlmkdvlglghkemakafeewnkteldsflieita
silkfqdadgkhllpkirdsagqkgtgkwtaisaleygvpvtligeavfarclsslkder
iqaskklkgpqnipfegdkksfledirkalyaskiisyaqgfmllrqaatefgwtlnygg
ialmwrggciirsvflgkikdafdrnpglqnlllddffksavencqdswrraistgvqag
ipmpcfttalsfydgyrhamlpanliqaqrdyfgahtyellakpgqfihtnwtghgg
SCOP Domain Coordinates for d2pgda1:
Click to download the PDB-style file with coordinates for d2pgda1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2pgda1:
- d2pgda1 first appeared (with stable ids) in SCOP 1.55, called d2pgd_1
- d2pgda1 appears in SCOP 1.73
- d2pgda1 appears in SCOPe 2.01
- d2pgda1 appears in the current release, SCOPe 2.08
View in 3D
