Lineage for d1brwa1 (1brw A:1-70)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 770284Fold a.46: Methionine synthase domain-like [47643] (3 superfamilies)
    4 helices; bundle, left-handed twist; right-handed superhelix
  4. 770294Superfamily a.46.2: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47648] (1 family) (S)
  5. 770295Family a.46.2.1: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47649] (3 proteins)
  6. 770332Protein Pyrimidine nucleoside phosphorylase [47652] (1 species)
  7. 770333Species Bacillus stearothermophilus [TaxId:1422] [47653] (1 PDB entry)
  8. 770334Domain d1brwa1: 1brw A:1-70 [17764]
    Other proteins in same PDB: d1brwa2, d1brwa3, d1brwb2, d1brwb3

Details for d1brwa1

PDB Entry: 1brw (more details), 2.1 Å

PDB Description: the crystal structure of pyrimidine nucleoside phosphorylase in a closed conformation
PDB Compounds: (A:) protein (pyrimidine nucleoside phosphorylase)

SCOP Domain Sequences for d1brwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1brwa1 a.46.2.1 (A:1-70) Pyrimidine nucleoside phosphorylase {Bacillus stearothermophilus [TaxId: 1422]}
mrmvdliakkrdgkaltkeeiewivrgytngdipdyqmsalamaiyfrgmteeetaaltm
amvqsgemld

SCOP Domain Coordinates for d1brwa1:

Click to download the PDB-style file with coordinates for d1brwa1.
(The format of our PDB-style files is described here.)

Timeline for d1brwa1: