| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.46: Methionine synthase domain-like [47643] (3 superfamilies) 4 helices; bundle, left-handed twist; right-handed superhelix |
Superfamily a.46.2: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47648] (2 families) ![]() automatically mapped to Pfam PF02885 |
| Family a.46.2.1: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47649] (3 proteins) |
| Protein Pyrimidine nucleoside phosphorylase [47652] (1 species) |
| Species Bacillus stearothermophilus [TaxId:1422] [47653] (1 PDB entry) |
| Domain d1brwa1: 1brw A:1-70 [17764] Other proteins in same PDB: d1brwa2, d1brwa3, d1brwb2, d1brwb3 complexed with ca, mes, po4, ura |
PDB Entry: 1brw (more details), 2.1 Å
SCOPe Domain Sequences for d1brwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1brwa1 a.46.2.1 (A:1-70) Pyrimidine nucleoside phosphorylase {Bacillus stearothermophilus [TaxId: 1422]}
mrmvdliakkrdgkaltkeeiewivrgytngdipdyqmsalamaiyfrgmteeetaaltm
amvqsgemld
Timeline for d1brwa1: