Lineage for d2i13a1 (2i13 A:31-184)
- Root: SCOP 1.75
Class k: Designed proteins [58788] (44 folds) 
Fold k.12: Zinc finger design [58856] (1 superfamily) Superfamily k.12.1: Zinc finger design [58857] (1 family) 
Family k.12.1.1: Zinc finger design [58858] (7 proteins) Protein AART, designed six-finger protein [144340] (1 species) Species synthetic [144341] (1 PDB entry) 
Domain d2i13a1: 2i13 A:31-184 [136964]
Details for d2i13a1
PDB Entry: 2i13 (more details), 1.96 Å
PDB Description: Aart, a six finger zinc finger designed to recognize ANN triplets
PDB Compounds: (A:) AartSCOP Domain Sequences for d2i13a1:
Sequence, based on SEQRES records: (download)
>d2i13a1 k.12.1.1 (A:31-184) AART, designed six-finger protein {synthetic}
fsrsdhlaehqrthtgekpykcpecgksfsdkkdltrhqrthtgekpykcpecgksfsqr
anlrahqrthtgekpyacpecgksfsqlahlrahqrthtgekpykcpecgksfsrednlh
thqrthtgekpykcpecgksfsrrdalnvhqrth
Sequence, based on observed residues (ATOM records): (download)
>d2i13a1 k.12.1.1 (A:31-184) AART, designed six-finger protein {synthetic}
fsrsdhlaehqrthkpykcpecgksfsdkkdltrhqrthtgekpykcpecgksfsqranl
rahqrthtgekpyacpecgksfsqlahlrahqrthtgekpykcpecgksfsrednlhthq
rthtgekpykcpecgksfsrrdalnvhqrth
SCOP Domain Coordinates for d2i13a1:
Click to download the PDB-style file with coordinates for d2i13a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2i13a1:
- d2i13a1 first appeared in SCOP 1.73
- d2i13a1 appears in SCOPe 2.01
- d2i13a1 appears in the current release, SCOPe 2.08
View in 3D
