Lineage for d2i13a1 (2i13 A:31-184)

  1. Root: SCOP 1.73
  2. 757717Class k: Designed proteins [58788] (44 folds)
  3. 757938Fold k.12: Zinc finger design [58856] (1 superfamily)
  4. 757939Superfamily k.12.1: Zinc finger design [58857] (1 family) (S)
  5. 757940Family k.12.1.1: Zinc finger design [58858] (6 proteins)
  6. 757941Protein AART, designed six-finger protein [144340] (1 species)
  7. 757942Species synthetic [144341] (1 PDB entry)
  8. 757943Domain d2i13a1: 2i13 A:31-184 [136964]

Details for d2i13a1

PDB Entry: 2i13 (more details), 1.96 Å

PDB Description: Aart, a six finger zinc finger designed to recognize ANN triplets
PDB Compounds: (A:) Aart

SCOP Domain Sequences for d2i13a1:

Sequence, based on SEQRES records: (download)

>d2i13a1 k.12.1.1 (A:31-184) AART, designed six-finger protein {synthetic}
fsrsdhlaehqrthtgekpykcpecgksfsdkkdltrhqrthtgekpykcpecgksfsqr
anlrahqrthtgekpyacpecgksfsqlahlrahqrthtgekpykcpecgksfsrednlh
thqrthtgekpykcpecgksfsrrdalnvhqrth

Sequence, based on observed residues (ATOM records): (download)

>d2i13a1 k.12.1.1 (A:31-184) AART, designed six-finger protein {synthetic}
fsrsdhlaehqrthkpykcpecgksfsdkkdltrhqrthtgekpykcpecgksfsqranl
rahqrthtgekpyacpecgksfsqlahlrahqrthtgekpykcpecgksfsrednlhthq
rthtgekpykcpecgksfsrrdalnvhqrth

SCOP Domain Coordinates for d2i13a1:

Click to download the PDB-style file with coordinates for d2i13a1.
(The format of our PDB-style files is described here.)

Timeline for d2i13a1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2i13b1