Lineage for d2g7oa1 (2g7o A:60-127)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 780803Fold a.241: TraM-like [140580] (1 superfamily)
    multihelical oligomeric protein; structure of whole subunit is not known; the N-terminal part is implicated in DNA binding, the middle region forms tetrameric parallel coiled coil, surrounded by the C-terminal helices
  4. 780804Superfamily a.241.1: TraM-like [140581] (1 family) (S)
  5. 780805Family a.241.1.1: TraM-like [140582] (1 protein)
    Pfam PF05261
  6. 780806Protein TraM [140583] (2 species)
    also includes the N-terminal domain structure 1dp3, previously classified into a different family ((63566))
    also includes the N-terminal domain structure 1dp3, previously classified into a different family ((63566))
  7. 780816Species Escherichia coli [TaxId:562] [140584] (2 PDB entries)
    Uniprot P10026 50-127! Uniprot P10026 60-167
  8. 780817Domain d2g7oa1: 2g7o A:60-127 [134736]

Details for d2g7oa1

PDB Entry: 2g7o (more details), 1.4 Å

PDB Description: protonation-mediated structural flexibility in the f conjugation regulatory protein, tram
PDB Compounds: (A:) Protein traM

SCOP Domain Sequences for d2g7oa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g7oa1 a.241.1.1 (A:60-127) TraM {Escherichia coli [TaxId: 562]}
afnqtefnklllecvvktqssvakilgieslsphvsgnskfeyanmvedirekvssemer
ffpkndde

SCOP Domain Coordinates for d2g7oa1:

Click to download the PDB-style file with coordinates for d2g7oa1.
(The format of our PDB-style files is described here.)

Timeline for d2g7oa1: