PDB entry 2g7o

View 2g7o on RCSB PDB site
Description: Protonation-mediated structural flexibility in the F conjugation regulatory protein, TraM
Class: DNA binding protein
Keywords: four helix bundle, tetramer
Deposited on 2006-02-28, released 2006-06-13
The last revision prior to the SCOP 1.75 freeze date was dated 2006-07-04, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.195
AEROSPACI score: 0.79 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein traM
    Species: Escherichia coli
    Gene: traM
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2g7oa1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2g7oA (A:)
esafnqtefnklllecvvktqssvakilgieslsphvsgnskfeyanmvedirekvssem
erffpkndde

    Sequence, based on observed residues (ATOM records): (download) 
    >2g7oA (A:)
afnqtefnklllecvvktqssvakilgieslsphvsgnskfeyanmvedirekvssemer
ffpkndde