Lineage for d2f2ga1 (2f2g A:5-219)
- Root: SCOP 1.75
Class a: All alpha proteins [46456] (284 folds) 
Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
multihelical; bundleSuperfamily a.132.1: Heme oxygenase-like [48613] (4 families) 
duplication: contains two structural repeats of 3-helical motif
Family a.132.1.3: TENA/THI-4 [101458] (8 proteins)
Pfam PF03070; HO-related family lacking the heme-binding site
Protein Seed maturation protein-related At3g16990 [101461] (1 species) Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [101462] (2 PDB entries)
structural genomics
Domain d2f2ga1: 2f2g A:5-219 [132816]
automatically matched to d1q4mb_
complexed with hmh, so4
Details for d2f2ga1
PDB Entry: 2f2g (more details), 2.1 Å
PDB Description: x-ray structure of gene product from arabidopsis thaliana at3g16990
PDB Compounds: (A:) seed maturation protein pm36 homologSCOP Domain Sequences for d2f2ga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f2ga1 a.132.1.3 (A:5-219) Seed maturation protein-related At3g16990 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gvidtwidkhrsiytaatrhafvvsirdgsvdlssfrtwlgqdylfvrrfvpfvasvlir
ackdsgessdmevvlggiaslndeiewfkregskwdvdfstvvpqranqeygrfledlms
sevkypvimtafwaieavyqesfahcledgnktpveltgachrwgndgfkqycssvknia
erclenasgevlgeaedvlvrvlelevafwemsrg
SCOP Domain Coordinates for d2f2ga1:
Click to download the PDB-style file with coordinates for d2f2ga1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2f2ga1:
- d2f2ga1 first appeared in SCOP 1.73
- d2f2ga1 is called d2f2ga_ in SCOPe 2.01
- d2f2ga1 appears in the current release, SCOPe 2.08, called d2f2ga_
View in 3D
