Lineage for d2f2ga_ (2f2g A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732616Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 2732617Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 2732777Family a.132.1.3: TENA/THI-4 [101458] (9 proteins)
    Pfam PF03070; HO-related family lacking the heme-binding site
  6. 2732807Protein Seed maturation protein-related At3g16990 [101461] (1 species)
  7. 2732808Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [101462] (2 PDB entries)
    structural genomics
  8. 2732811Domain d2f2ga_: 2f2g A: [132816]
    automated match to d1q4mb_
    complexed with hmh, so4

Details for d2f2ga_

PDB Entry: 2f2g (more details), 2.1 Å

PDB Description: x-ray structure of gene product from arabidopsis thaliana at3g16990
PDB Compounds: (A:) seed maturation protein pm36 homolog

SCOPe Domain Sequences for d2f2ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f2ga_ a.132.1.3 (A:) Seed maturation protein-related At3g16990 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gvidtwidkhrsiytaatrhafvvsirdgsvdlssfrtwlgqdylfvrrfvpfvasvlir
ackdsgessdmevvlggiaslndeiewfkregskwdvdfstvvpqranqeygrfledlms
sevkypvimtafwaieavyqesfahcledgnktpveltgachrwgndgfkqycssvknia
erclenasgevlgeaedvlvrvlelevafwemsrg

SCOPe Domain Coordinates for d2f2ga_:

Click to download the PDB-style file with coordinates for d2f2ga_.
(The format of our PDB-style files is described here.)

Timeline for d2f2ga_: