Lineage for d2erxa1 (2erx A:6-176)
- Root: SCOP 1.75
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) 
division into families based on beta-sheet topologies
Family c.37.1.8: G proteins [52592] (78 proteins)
core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
Protein di-Ras2 [142267] (1 species) Species Human (Homo sapiens) [TaxId:9606] [142268] (1 PDB entry)
Uniprot Q96HU8 6-176
Domain d2erxa1: 2erx A:6-176 [132304]
complexed with gdp, mg, po4
Details for d2erxa1
PDB Entry: 2erx (more details), 1.65 Å
PDB Description: Crystal Structure of DiRas2 in Complex With GDP and Inorganic Phosphate
PDB Compounds: (A:) GTP-binding protein Di-Ras2SCOP Domain Sequences for d2erxa1:
Sequence, based on SEQRES records: (download)
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]}
ndyrvavfgaggvgksslvlrfvkgtfresyiptvedtyrqviscdksictlqitdttgs
hqfpamqrlsiskghafilvysitsrqsleelkpiyeqiceikgdvesipimlvgnkcde
spsrevqsseaealartwkcafmetsaklnhnvkelfqellnlekrrtvsl
Sequence, based on observed residues (ATOM records): (download)
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]}
ndyrvavfgaggvgksslvlrfvkgtfresyiptvedtyrqviscdksictlqitdttgs
hqfpamqrlsiskghafilvysitsrqsleelkpiyeqiceikgsipimlvgnkcdesps
revqsseaealartwkcafmetsaklnhnvkelfqellnlekrrtvsl
SCOP Domain Coordinates for d2erxa1:
Click to download the PDB-style file with coordinates for d2erxa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2erxa1:
- d2erxa1 first appeared in SCOP 1.73
- d2erxa1 appears in SCOPe 2.01
- d2erxa1 appears in the current release, SCOPe 2.08
View in 3D
