Lineage for d2erxa1 (2erx A:6-176)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 695085Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 695086Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 695634Family c.37.1.8: G proteins [52592] (78 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 695810Protein di-Ras2 [142267] (1 species)
  7. 695811Species Human (Homo sapiens) [TaxId:9606] [142268] (1 PDB entry)
  8. 695812Domain d2erxa1: 2erx A:6-176 [132304]
    complexed with gdp, mg, po4

Details for d2erxa1

PDB Entry: 2erx (more details), 1.65 Å

PDB Description: Crystal Structure of DiRas2 in Complex With GDP and Inorganic Phosphate
PDB Compounds: (A:) GTP-binding protein Di-Ras2

SCOP Domain Sequences for d2erxa1:

Sequence, based on SEQRES records: (download)

>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]}
ndyrvavfgaggvgksslvlrfvkgtfresyiptvedtyrqviscdksictlqitdttgs
hqfpamqrlsiskghafilvysitsrqsleelkpiyeqiceikgdvesipimlvgnkcde
spsrevqsseaealartwkcafmetsaklnhnvkelfqellnlekrrtvsl

Sequence, based on observed residues (ATOM records): (download)

>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]}
ndyrvavfgaggvgksslvlrfvkgtfresyiptvedtyrqviscdksictlqitdttgs
hqfpamqrlsiskghafilvysitsrqsleelkpiyeqiceikgsipimlvgnkcdesps
revqsseaealartwkcafmetsaklnhnvkelfqellnlekrrtvsl

SCOP Domain Coordinates for d2erxa1:

Click to download the PDB-style file with coordinates for d2erxa1.
(The format of our PDB-style files is described here.)

Timeline for d2erxa1: