Lineage for d2b0ja1 (2b0j A:243-344)
- Root: SCOP 1.75
Class a: All alpha proteins [46456] (284 folds) 
Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetrySuperfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (12 families) 
N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
Family a.100.1.11: HMD dimerization domain-like [140777] (1 protein)
dimer similar to those of the GDP-mannose 6-dehydrogenase and class I KARI domainsProtein 5,10-methenyltetrahydromethanopterin hydrogenase, HMD [140778] (1 species) Species Archaeon Methanocaldococcus jannaschii [TaxId:2190] [140779] (1 PDB entry)
Uniprot Q58194 243-344
Domain d2b0ja1: 2b0j A:243-344 [127639]
Other proteins in same PDB: d2b0ja2
Details for d2b0ja1
PDB Entry: 2b0j (more details), 1.75 Å
PDB Description: The crystal structure of the apoenzyme of the iron-sulfur-cluster-free hydrogenase (Hmd)
PDB Compounds: (A:) 5,10-methenyltetrahydromethanopterin hydrogenaseSCOP Domain Sequences for d2b0ja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b0ja1 a.100.1.11 (A:243-344) 5,10-methenyltetrahydromethanopterin hydrogenase, HMD {Archaeon Methanocaldococcus jannaschii [TaxId: 2190]}
anligpvcdmcsavtatvyagllayrdavtkilgapadfaqmmadealtqihnlmkekgi
anmeealdpaallgtadsmcfgplaeilptalkvlekhkvve
SCOP Domain Coordinates for d2b0ja1:
Click to download the PDB-style file with coordinates for d2b0ja1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2b0ja1:
- d2b0ja1 first appeared in SCOP 1.73
- d2b0ja1 appears in SCOPe 2.01
- d2b0ja1 appears in the current release, SCOPe 2.08
View in 3D
