Lineage for d2an9a1 (2an9 A:3-206)
- Root: SCOP 1.75
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) 
division into families based on beta-sheet topologies
Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (20 proteins)
parallel beta-sheet of 5 strands, order 23145
Protein Guanylate kinase [52542] (4 species) 
Species Escherichia coli [TaxId:562] [102338] (6 PDB entries) 
Domain d2an9a1: 2an9 A:3-206 [127037]
automatically matched to d1s96a_
complexed with gdp, gmp, k
Details for d2an9a1
PDB Entry: 2an9 (more details), 2.35 Å
PDB Description: Crystal Structure Of Oligomeric E.coli Guanylate Kinase In Complex With GDP
PDB Compounds: (A:) Guanylate kinaseSCOP Domain Sequences for d2an9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2an9a1 c.37.1.1 (A:3-206) Guanylate kinase {Escherichia coli [TaxId: 562]}
qgtlyivsapsgagkssliqallktqplydtqvsvshttrqprpgevhgehyffvnhdef
kemisrdaflehaevfgnyygtsreaieqvlatgvdvfldidwqgaqqirqkmpharsif
ilppskieldrrlrgrgqdseeviakrmaqavaemshyaeydylivnddfdtaltdlkti
iraerlrmsrqkqrhdalisklla
SCOP Domain Coordinates for d2an9a1:
Click to download the PDB-style file with coordinates for d2an9a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2an9a1:
- d2an9a1 first appeared in SCOP 1.73
- d2an9a1 is called d2an9a_ in SCOPe 2.01
- d2an9a1 appears in the current release, SCOPe 2.08, called d2an9a_
View in 3D
