Lineage for d2an9a1 (2an9 A:3-206)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 695085Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 695086Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 695087Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (20 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 695228Protein Guanylate kinase [52542] (4 species)
  7. 695234Species Escherichia coli [TaxId:562] [102338] (6 PDB entries)
  8. 695237Domain d2an9a1: 2an9 A:3-206 [127037]
    automatically matched to d1s96a_
    complexed with gdp, gmp, k

Details for d2an9a1

PDB Entry: 2an9 (more details), 2.35 Å

PDB Description: Crystal Structure Of Oligomeric E.coli Guanylate Kinase In Complex With GDP
PDB Compounds: (A:) Guanylate kinase

SCOP Domain Sequences for d2an9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2an9a1 c.37.1.1 (A:3-206) Guanylate kinase {Escherichia coli [TaxId: 562]}
qgtlyivsapsgagkssliqallktqplydtqvsvshttrqprpgevhgehyffvnhdef
kemisrdaflehaevfgnyygtsreaieqvlatgvdvfldidwqgaqqirqkmpharsif
ilppskieldrrlrgrgqdseeviakrmaqavaemshyaeydylivnddfdtaltdlkti
iraerlrmsrqkqrhdalisklla

SCOP Domain Coordinates for d2an9a1:

Click to download the PDB-style file with coordinates for d2an9a1.
(The format of our PDB-style files is described here.)

Timeline for d2an9a1: