Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (9 families) conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
Family c.23.16.7: LD-carboxypeptidase A N-terminal domain-like [142074] (1 protein) N-terminal half of Pfam PF02016 |
Protein LD-carboxypeptidase A, N-terminal domain [142075] (1 species) |
Species Pseudomonas aeruginosa [TaxId:287] [142076] (4 PDB entries) Uniprot Q9HTZ1 3-169! Uniprot Q9HTZ1 5-142! Uniprot Q9HTZ1 5-169 |
Domain d1zl0a2: 1zl0 A:3-169 [125232] Other proteins in same PDB: d1zl0a1, d1zl0b1 complexed with edo, gol, k, na, peg, tla |
PDB Entry: 1zl0 (more details), 1.1 Å
SCOP Domain Sequences for d1zl0a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zl0a2 c.23.16.7 (A:3-169) LD-carboxypeptidase A, N-terminal domain {Pseudomonas aeruginosa [TaxId: 287]} srpssdqtwqpidgrvaliapasaiatdvleatlrqlevhgvdyhlgrhvearyrylagt veqrledlhnafdmpditavwclrggygcgqllpgldwgrlqaasprpligfsdisvlls afhrhglpaihgpvatglglsplsapreqqerlaslasvsrllagid
Timeline for d1zl0a2: