Lineage for d1zl0a2 (1zl0 A:3-169)
- Root: SCOP 1.75
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (9 families) 
conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
Family c.23.16.7: LD-carboxypeptidase A N-terminal domain-like [142074] (1 protein)
N-terminal half of Pfam PF02016Protein LD-carboxypeptidase A, N-terminal domain [142075] (1 species) Species Pseudomonas aeruginosa [TaxId:287] [142076] (4 PDB entries)
Uniprot Q9HTZ1 3-169! Uniprot Q9HTZ1 5-142! Uniprot Q9HTZ1 5-169
Domain d1zl0a2: 1zl0 A:3-169 [125232]
Other proteins in same PDB: d1zl0a1, d1zl0b1
complexed with edo, gol, k, na, peg, tla
Details for d1zl0a2
PDB Entry: 1zl0 (more details), 1.1 Å
PDB Description: Structure of Protein of Unknown Function PA5198 from Pseudomonas aeruginosa
PDB Compounds: (A:) hypothetical protein PA5198SCOP Domain Sequences for d1zl0a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zl0a2 c.23.16.7 (A:3-169) LD-carboxypeptidase A, N-terminal domain {Pseudomonas aeruginosa [TaxId: 287]}
srpssdqtwqpidgrvaliapasaiatdvleatlrqlevhgvdyhlgrhvearyrylagt
veqrledlhnafdmpditavwclrggygcgqllpgldwgrlqaasprpligfsdisvlls
afhrhglpaihgpvatglglsplsapreqqerlaslasvsrllagid
SCOP Domain Coordinates for d1zl0a2:
Click to download the PDB-style file with coordinates for d1zl0a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1zl0a2:
- d1zl0a2 first appeared in SCOP 1.73
- d1zl0a2 appears in SCOPe 2.01
- d1zl0a2 appears in the current release, SCOPe 2.08
View in 3D
