Lineage for d1zkga2 (1zkg A:76-200)
- Root: SCOP 1.75
Class a: All alpha proteins [46456] (284 folds) 
Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
multihelical; interlocked (homo)dimerSuperfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (1 family) 
Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (34 proteins) 
Protein Transcriptional regulator TM1030 [140877] (1 species) Species Thermotoga maritima [TaxId:2336] [140878] (4 PDB entries)
Uniprot Q9X0C0 76-200
Domain d1zkga2: 1zkg A:76-200 [125195]
Other proteins in same PDB: d1zkga1, d1zkgb1
complexed with unl
Details for d1zkga2
PDB Entry: 1zkg (more details), 2.3 Å
PDB Description: Crystal structure of Transcriptional regulator, TETR family (tm1030) from Thermotoga maritima at 2.30 A resolution
PDB Compounds: (A:) TRANSCRIPTIONAL REGULATOR, TetR FAMILYSCOP Domain Sequences for d1zkga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zkga2 a.121.1.1 (A:76-200) Transcriptional regulator TM1030 {Thermotoga maritima [TaxId: 2336]}
rdifdfmerwiekkleysashpeeadflitlvsvdeglrkrilldleksqrvffdfvrek
lkdldlaedvteeialkflmwffsgfeevylrtyqgkpellkrdmntlveevkvmlrilk
kgmtk
SCOP Domain Coordinates for d1zkga2:
Click to download the PDB-style file with coordinates for d1zkga2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1zkga2:
- d1zkga2 first appeared in SCOP 1.73
- d1zkga2 appears in SCOPe 2.01
- d1zkga2 appears in the current release, SCOPe 2.08
View in 3D
