Lineage for d1z3aa1 (1z3a A:13-168)
- Root: SCOP 1.75
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the restSuperfamily c.97.1: Cytidine deaminase-like [53927] (5 families) 
contains extra C-terminal strand 5, order 21345Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (7 proteins)
strand 5 is parallel to strand 4
Protein tRNA adenosine deaminase TadA [142840] (3 species) 
Species Escherichia coli [TaxId:562] [142842] (1 PDB entry)
Uniprot P68398 13-168
Domain d1z3aa1: 1z3a A:13-168 [124396]
complexed with zn
Details for d1z3aa1
PDB Entry: 1z3a (more details), 2.03 Å
PDB Description: crystal structure of trna adenosine deaminase tada from escherichia coli
PDB Compounds: (A:) tRNA-specific adenosine deaminaseSCOP Domain Sequences for d1z3aa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z3aa1 c.97.1.2 (A:13-168) tRNA adenosine deaminase TadA {Escherichia coli [TaxId: 562]}
sevefsheywmrhaltlakrawderevpvgavlvhnnrvigegwnrpigrhdptahaeim
alrqgglvmqnyrlidatlyvtlepcvmcagamihsrigrvvfgardaktgaagslmdvl
hhpgmnhrveitegiladecaallsdffrmrrqeik
SCOP Domain Coordinates for d1z3aa1:
Click to download the PDB-style file with coordinates for d1z3aa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1z3aa1:
- d1z3aa1 first appeared in SCOP 1.73
- d1z3aa1 appears in SCOPe 2.01
- d1z3aa1 appears in the current release, SCOPe 2.08
View in 3D
