Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies) core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest |
Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) contains extra C-terminal strand 5, order 21345 |
Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (8 proteins) strand 5 is parallel to strand 4 |
Protein tRNA adenosine deaminase TadA [142840] (3 species) |
Species Escherichia coli [TaxId:562] [142842] (1 PDB entry) Uniprot P68398 13-168 |
Domain d1z3aa1: 1z3a A:13-168 [124396] complexed with zn |
PDB Entry: 1z3a (more details), 2.03 Å
SCOPe Domain Sequences for d1z3aa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z3aa1 c.97.1.2 (A:13-168) tRNA adenosine deaminase TadA {Escherichia coli [TaxId: 562]} sevefsheywmrhaltlakrawderevpvgavlvhnnrvigegwnrpigrhdptahaeim alrqgglvmqnyrlidatlyvtlepcvmcagamihsrigrvvfgardaktgaagslmdvl hhpgmnhrveitegiladecaallsdffrmrrqeik
Timeline for d1z3aa1: