Class b: All beta proteins [48724] (174 folds) |
Fold b.55: PH domain-like barrel [50728] (2 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.2: PA2021-like [141447] (1 family) prokaryotiic proteins of PH domain-like fold lacking the N-terminal strand |
Family b.55.2.1: PA2021-like [141448] (1 protein) small family specific to Pseudomonas |
Protein Hypothetical protein PA2021 [141449] (1 species) |
Species Pseudomonas aeruginosa [TaxId:287] [141450] (1 PDB entry) Uniprot Q9I293 1-74 |
Domain d1ywya1: 1ywy A:23-96 [124166] |
PDB Entry: 1ywy (more details)
SCOP Domain Sequences for d1ywya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ywya1 b.55.2.1 (A:23-96) Hypothetical protein PA2021 {Pseudomonas aeruginosa [TaxId: 287]} msieidseqgvcsveiegsrhrapvdslrigtdaearlsvlyidgkrlhiseedaqrlvv agaedqrrhlmadd
Timeline for d1ywya1: