Lineage for d1ywya1 (1ywy A:23-96)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803967Superfamily b.55.2: PA2021-like [141447] (1 family) (S)
    prokaryotiic proteins of PH domain-like fold lacking the N-terminal strand
    automatically mapped to Pfam PF11462
  5. 2803968Family b.55.2.1: PA2021-like [141448] (1 protein)
    small family specific to Pseudomonas
  6. 2803969Protein Hypothetical protein PA2021 [141449] (1 species)
  7. 2803970Species Pseudomonas aeruginosa [TaxId:287] [141450] (1 PDB entry)
    Uniprot Q9I293 1-74
  8. 2803971Domain d1ywya1: 1ywy A:23-96 [124166]

Details for d1ywya1

PDB Entry: 1ywy (more details)

PDB Description: Solution Structure of Pseudomonas aeruginosa Protein PA2021. The Northeast Structural Genomics Consortium Target Pat85.
PDB Compounds: (A:) hypothetical protein PA2021

SCOPe Domain Sequences for d1ywya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ywya1 b.55.2.1 (A:23-96) Hypothetical protein PA2021 {Pseudomonas aeruginosa [TaxId: 287]}
msieidseqgvcsveiegsrhrapvdslrigtdaearlsvlyidgkrlhiseedaqrlvv
agaedqrrhlmadd

SCOPe Domain Coordinates for d1ywya1:

Click to download the PDB-style file with coordinates for d1ywya1.
(The format of our PDB-style files is described here.)

Timeline for d1ywya1: