Lineage for d1yt8a2 (1yt8 A:6-106)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 833370Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451
  4. 833371Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (4 families) (S)
    Pfam PF00581
    the active site structure is similar to those of the families I and II protein phosphatases; the topology can be related by a different circular permutation to the family I topology
  5. 833399Family c.46.1.2: Multidomain sulfurtransferase (rhodanese) [52827] (4 proteins)
    duplication: consists of two domains of this fold
  6. 833436Protein Thiosulfate sulfurtransferase PA2603 [142351] (1 species)
  7. 833437Species Pseudomonas aeruginosa [TaxId:287] [142352] (1 PDB entry)
    Uniprot Q9I0N4 105-240! Uniprot Q9I0N4 241-370! Uniprot Q9I0N4 371-527! Uniprot Q9I0N4 4-104
  8. 833439Domain d1yt8a2: 1yt8 A:6-106 [123997]
    complexed with gol, so3

Details for d1yt8a2

PDB Entry: 1yt8 (more details), 1.9 Å

PDB Description: crystal structure of thiosulfate sulfurtransferase from pseudomonas aeruginosa
PDB Compounds: (A:) thiosulfate sulfurtransferase

SCOP Domain Sequences for d1yt8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yt8a2 c.46.1.2 (A:6-106) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]}
iavrtfhdiraallarrelalldvreedpfaqahplfaanlplsrleleiharvprrdtp
itvyddgeglapvaaqrlhdlgysdvalldgglsgwrnagg

SCOP Domain Coordinates for d1yt8a2:

Click to download the PDB-style file with coordinates for d1yt8a2.
(The format of our PDB-style files is described here.)

Timeline for d1yt8a2: