![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451 |
![]() | Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (4 families) ![]() Pfam PF00581 the active site structure is similar to those of the families I and II protein phosphatases; the topology can be related by a different circular permutation to the family I topology |
![]() | Family c.46.1.2: Multidomain sulfurtransferase (rhodanese) [52827] (4 proteins) duplication: consists of two domains of this fold |
![]() | Protein Thiosulfate sulfurtransferase PA2603 [142351] (1 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [142352] (1 PDB entry) |
![]() | Domain d1yt8a2: 1yt8 A:6-106 [123997] complexed with gol, so3 |
PDB Entry: 1yt8 (more details), 1.9 Å
SCOP Domain Sequences for d1yt8a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yt8a2 c.46.1.2 (A:6-106) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} iavrtfhdiraallarrelalldvreedpfaqahplfaanlplsrleleiharvprrdtp itvyddgeglapvaaqrlhdlgysdvalldgglsgwrnagg
Timeline for d1yt8a2: