Lineage for d1xzoa1 (1xzo A:3-174)
- Root: SCOP 1.75
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the restSuperfamily c.47.1: Thioredoxin-like [52833] (23 families) 
Family c.47.1.10: Glutathione peroxidase-like [52901] (28 proteins) 
Protein Thioredoxin-like protein Sco1 (YpmQ), soluble domain [102459] (3 species) 
Species Bacillus subtilis [TaxId:1423] [102460] (2 PDB entries) 
Domain d1xzoa1: 1xzo A:3-174 [122474]
complexed with ca, cd
Details for d1xzoa1
PDB Entry: 1xzo (more details), 1.7 Å
PDB Description: identification of a disulfide switch in bssco, a member of the sco family of cytochrome c oxidase assembly proteins
PDB Compounds: (A:) Hypothetical protein ypmQSCOP Domain Sequences for d1xzoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xzoa1 c.47.1.10 (A:3-174) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Bacillus subtilis [TaxId: 1423]}
qqikdplnyevepftfqnqdgknvsleslkgevwladfiftnceticppmtahmtdlqkk
lkaenidvriisfsvdpendkpkqlkkfaanyplsfdnwdfltgysqseieefalksfka
ivkkpegedqvihqssfylvgpdgkvlkdyngventpyddiisdvksastlk
SCOP Domain Coordinates for d1xzoa1:
Click to download the PDB-style file with coordinates for d1xzoa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1xzoa1:
- d1xzoa1 first appeared in SCOP 1.73
- d1xzoa1 appears in SCOPe 2.01
- d1xzoa1 appears in the current release, SCOPe 2.08
View in 3D
