SCOPe 2.08: Domain d1xzoa1: 1xzo A:3-174

Lineage for d1xzoa1 (1xzo A:3-174)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)

6. Protein Thioredoxin-like protein Sco1 (YpmQ), soluble domain [102459] (3 species)

7. Species Bacillus subtilis [TaxId:1423] [102460] (2 PDB entries)

8. Domain d1xzoa1: 1xzo A:3-174 [122474]
   complexed with ca, cd

Details for d1xzoa1

PDB Entry: 1xzo, 1.7 Å

PDB Description: identification of a disulfide switch in bssco, a member of the sco family of cytochrome c oxidase assembly proteins

PDB Compounds: (A:) Hypothetical protein ypmQ

SCOPe Domain Sequences for d1xzoa1:

Sequence; same for both SEQRES and ATOM records:

>d1xzoa1 c.47.1.10 (A:3-174) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Bacillus subtilis [TaxId: 1423]}
qqikdplnyevepftfqnqdgknvsleslkgevwladfiftnceticppmtahmtdlqkk
lkaenidvriisfsvdpendkpkqlkkfaanyplsfdnwdfltgysqseieefalksfka
ivkkpegedqvihqssfylvgpdgkvlkdyngventpyddiisdvksastlk

Timeline for d1xzoa1:

• d1xzoa1 first appeared in SCOP 1.73
  
• d1xzoa1 appears in SCOPe 2.07