Class b: All beta proteins [48724] (174 folds) |
Fold b.122: PUA domain-like [88696] (1 superfamily) pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other |
Superfamily b.122.1: PUA domain-like [88697] (13 families) |
Family b.122.1.8: Atu2648/PH1033-like [141703] (6 proteins) Pfam PF01878; DUF55 |
Protein Hypothetical protein PH1033 [141706] (1 species) |
Species Pyrococcus horikoshii [TaxId:53953] [141707] (3 PDB entries) Uniprot O58764 1-145 |
Domain d1wmma1: 1wmm A:1-145 [121049] |
PDB Entry: 1wmm (more details), 2.2 Å
SCOP Domain Sequences for d1wmma1:
Sequence, based on SEQRES records: (download)
>d1wmma1 b.122.1.8 (A:1-145) Hypothetical protein PH1033 {Pyrococcus horikoshii [TaxId: 53953]} mtywicitnrenwevikrhnvwgvpkkhkntlsrvkpgdklviyvrqekdkegnllepki vgiyevtsepyvdfsrifkphrggketypyrvkikpikigeinfkplindlkfiknkkrw smhffgkamrelpeedyklieklll
>d1wmma1 b.122.1.8 (A:1-145) Hypothetical protein PH1033 {Pyrococcus horikoshii [TaxId: 53953]} mtywicitnrenwevikrhnvwgvpkkhkntlsrvkpgdklviyvrqekdkegnllepki vgiyevtsepyvdfsrifkpggketypyrvkikpikigeinfkplindlkfiknkkrwsm hffgkamrelpeedyklieklll
Timeline for d1wmma1: