Lineage for d1wmma1 (1wmm A:1-145)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 680324Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 680325Superfamily b.122.1: PUA domain-like [88697] (10 families) (S)
  5. 680447Family b.122.1.8: Atu2648/PH1033-like [141703] (6 proteins)
    Pfam PF01878; DUF55
  6. 680454Protein Hypothetical protein PH1033 [141706] (1 species)
  7. 680455Species Pyrococcus horikoshii [TaxId:53953] [141707] (1 PDB entry)
  8. 680456Domain d1wmma1: 1wmm A:1-145 [121049]

Details for d1wmma1

PDB Entry: 1wmm (more details), 2.2 Å

PDB Description: Crystal structure of PH1033 from Pyrococcus horikoshii Ot3
PDB Compounds: (A:) Hypothetical UPF0310 protein PH1033

SCOP Domain Sequences for d1wmma1:

Sequence, based on SEQRES records: (download)

>d1wmma1 b.122.1.8 (A:1-145) Hypothetical protein PH1033 {Pyrococcus horikoshii [TaxId: 53953]}
mtywicitnrenwevikrhnvwgvpkkhkntlsrvkpgdklviyvrqekdkegnllepki
vgiyevtsepyvdfsrifkphrggketypyrvkikpikigeinfkplindlkfiknkkrw
smhffgkamrelpeedyklieklll

Sequence, based on observed residues (ATOM records): (download)

>d1wmma1 b.122.1.8 (A:1-145) Hypothetical protein PH1033 {Pyrococcus horikoshii [TaxId: 53953]}
mtywicitnrenwevikrhnvwgvpkkhkntlsrvkpgdklviyvrqekdkegnllepki
vgiyevtsepyvdfsrifkpggketypyrvkikpikigeinfkplindlkfiknkkrwsm
hffgkamrelpeedyklieklll

SCOP Domain Coordinates for d1wmma1:

Click to download the PDB-style file with coordinates for d1wmma1.
(The format of our PDB-style files is described here.)

Timeline for d1wmma1: