Class a: All alpha proteins [46456] (284 folds) |
Fold a.84: Scaffolding protein gpD of bacteriophage procapsid [48044] (1 superfamily) core: 6 helices; one central helix is surrounded by 5 others |
Superfamily a.84.1: Scaffolding protein gpD of bacteriophage procapsid [48045] (1 family) |
Family a.84.1.1: Scaffolding protein gpD of bacteriophage procapsid [48046] (1 protein) |
Protein Scaffolding protein gpD of bacteriophage procapsid [48047] (1 species) |
Species Bacteriophage phi-X174 [TaxId:10847] [48048] (3 PDB entries) |
Domain d1tx9a1: 1tx9 A:7-144 [119383] automatically matched to d1al04_ |
PDB Entry: 1tx9 (more details), 3.31 Å
SCOP Domain Sequences for d1tx9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tx9a1 a.84.1.1 (A:7-144) Scaffolding protein gpD of bacteriophage procapsid {Bacteriophage phi-X174 [TaxId: 10847]} qsvrfqtalasikliqasavldlteddfdfltsnkvwiatdrsrarrcveacvygtldfv gyprfpapvefiaaviayyvhpvniqtaclimegaefteniingverpvkaaelfaftlr vragntdvltdaeenvrq
Timeline for d1tx9a1: