Lineage for d1tx9a1 (1tx9 A:7-144)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719385Fold a.84: Scaffolding protein gpD of bacteriophage procapsid [48044] (1 superfamily)
    core: 6 helices; one central helix is surrounded by 5 others
  4. 2719386Superfamily a.84.1: Scaffolding protein gpD of bacteriophage procapsid [48045] (1 family) (S)
    automatically mapped to Pfam PF02925
  5. 2719387Family a.84.1.1: Scaffolding protein gpD of bacteriophage procapsid [48046] (1 protein)
  6. 2719388Protein Scaffolding protein gpD of bacteriophage procapsid [48047] (1 species)
  7. 2719389Species Bacteriophage phi-X174 [TaxId:10847] [48048] (3 PDB entries)
  8. 2719390Domain d1tx9a1: 1tx9 A:7-144 [119383]
    automatically matched to d1al04_

Details for d1tx9a1

PDB Entry: 1tx9 (more details), 3.31 Å

PDB Description: gpd prior to capsid assembly
PDB Compounds: (A:) Scaffolding protein D

SCOPe Domain Sequences for d1tx9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tx9a1 a.84.1.1 (A:7-144) Scaffolding protein gpD of bacteriophage procapsid {Bacteriophage phi-X174 [TaxId: 10847]}
qsvrfqtalasikliqasavldlteddfdfltsnkvwiatdrsrarrcveacvygtldfv
gyprfpapvefiaaviayyvhpvniqtaclimegaefteniingverpvkaaelfaftlr
vragntdvltdaeenvrq

SCOPe Domain Coordinates for d1tx9a1:

Click to download the PDB-style file with coordinates for d1tx9a1.
(The format of our PDB-style files is described here.)

Timeline for d1tx9a1: