Class a: All alpha proteins [46456] (284 folds) |
Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.4: Rad51 N-terminal domain-like [47794] (3 families) contains one classic and one pseudo HhH motifs |
Family a.60.4.3: Hypothetical protein AF1548, C-terminal domain [116936] (1 protein) |
Protein Hypothetical protein AF1548, C-terminal domain [116937] (1 species) |
Species Archaeoglobus fulgidus [TaxId:2234] [116938] (1 PDB entry) SQ 28724 |
Domain d1y88a1: 1y88 A:128-186 [116560] Other proteins in same PDB: d1y88a2 Structural genomics target complexed with cl, so4 |
PDB Entry: 1y88 (more details), 1.85 Å
SCOP Domain Sequences for d1y88a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y88a1 a.60.4.3 (A:128-186) Hypothetical protein AF1548, C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} ypitilridkevldelvraglvfcrdvvsageeklreiglsakkareviaeakkviggs
Timeline for d1y88a1: