Lineage for d1y88a1 (1y88 A:128-186)
- Root: SCOP 1.75
Class a: All alpha proteins [46456] (284 folds) 
Fold a.60: SAM domain-like [47768] (16 superfamilies)
4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
Superfamily a.60.4: Rad51 N-terminal domain-like [47794] (3 families) 
contains one classic and one pseudo HhH motifs
Family a.60.4.3: Hypothetical protein AF1548, C-terminal domain [116936] (1 protein) Protein Hypothetical protein AF1548, C-terminal domain [116937] (1 species) Species Archaeoglobus fulgidus [TaxId:2234] [116938] (1 PDB entry)
SQ 28724
Domain d1y88a1: 1y88 A:128-186 [116560]
Other proteins in same PDB: d1y88a2
Structural genomics target
complexed with cl, so4
Details for d1y88a1
PDB Entry: 1y88 (more details), 1.85 Å
PDB Description: Crystal Structure of Protein of Unknown Function AF1548
PDB Compounds: (A:) Hypothetical protein AF1548SCOP Domain Sequences for d1y88a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y88a1 a.60.4.3 (A:128-186) Hypothetical protein AF1548, C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]}
ypitilridkevldelvraglvfcrdvvsageeklreiglsakkareviaeakkviggs
SCOP Domain Coordinates for d1y88a1:
Click to download the PDB-style file with coordinates for d1y88a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1y88a1:
- d1y88a1 first appeared in SCOP 1.71
- d1y88a1 appears in SCOP 1.73
- d1y88a1 appears in SCOPe 2.01
- d1y88a1 appears in the current release, SCOPe 2.08
View in 3D
