SCOP 1.71: Domain d1y88a1: 1y88 A:128-186

Lineage for d1y88a1 (1y88 A:128-186)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.60: SAM domain-like [47768] (14 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.4: Rad51 N-terminal domain-like [47794] (3 families)
   contains one classic and one pseudo HhH motifs

5. Family a.60.4.3: Hypothetical protein AF1548, C-terminal domain [116936] (1 protein)

6. Protein Hypothetical protein AF1548, C-terminal domain [116937] (1 species)

7. Species Archaeoglobus fulgidus [TaxId:2234] [116938] (1 PDB entry)

8. Domain d1y88a1: 1y88 A:128-186 [116560]
   Other proteins in same PDB: d1y88a2
   Structural genomics target
   complexed with cl, so4

Details for d1y88a1

PDB Entry: 1y88, 1.85 Å

PDB Description: Crystal Structure of Protein of Unknown Function AF1548

SCOP Domain Sequences for d1y88a1:

Sequence; same for both SEQRES and ATOM records:

>d1y88a1 a.60.4.3 (A:128-186) Hypothetical protein AF1548, C-terminal domain {Archaeoglobus fulgidus}
ypitilridkevldelvraglvfcrdvvsageeklreiglsakkareviaeakkviggs

Timeline for d1y88a1:

• d1y88a1 is new in SCOP 1.71
  
• d1y88a1 appears in SCOP 1.73
  
• d1y88a1 appears in the current release, SCOPe 2.08