Lineage for d1y88a1 (1y88 A:128-186)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 539305Fold a.60: SAM domain-like [47768] (14 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 539425Superfamily a.60.4: Rad51 N-terminal domain-like [47794] (3 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 539447Family a.60.4.3: Hypothetical protein AF1548, C-terminal domain [116936] (1 protein)
  6. 539448Protein Hypothetical protein AF1548, C-terminal domain [116937] (1 species)
  7. 539449Species Archaeoglobus fulgidus [TaxId:2234] [116938] (1 PDB entry)
  8. 539450Domain d1y88a1: 1y88 A:128-186 [116560]
    Other proteins in same PDB: d1y88a2
    Structural genomics target
    complexed with cl, so4

Details for d1y88a1

PDB Entry: 1y88 (more details), 1.85 Å

PDB Description: Crystal Structure of Protein of Unknown Function AF1548

SCOP Domain Sequences for d1y88a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y88a1 a.60.4.3 (A:128-186) Hypothetical protein AF1548, C-terminal domain {Archaeoglobus fulgidus}
ypitilridkevldelvraglvfcrdvvsageeklreiglsakkareviaeakkviggs

SCOP Domain Coordinates for d1y88a1:

Click to download the PDB-style file with coordinates for d1y88a1.
(The format of our PDB-style files is described here.)

Timeline for d1y88a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1y88a2