Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
Superfamily c.52.1: Restriction endonuclease-like [52980] (33 families) |
Family c.52.1.26: Hypothetical protein VC1899 [117625] (1 protein) contains 2 extra N-terminal domains; d1: [alpha/beta; 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest; topological similarity to the Formyltransferase fold ((53327))]; d2: [distorted "winged helix" fold ((46785))] contains 2 extra N-terminal domains; d1: [alpha/beta; 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest; topological similarity to the Formyltransferase fold ((53327))]; d2: [distorted "winged helix" fold (46785))] |
Protein Hypothetical protein VC1899 [117626] (1 species) |
Species Vibrio cholerae [TaxId:666] [117627] (1 PDB entry) Uniprot Q9KQU9 # d1 (1-156); d2 (161-249); putative catalytic domain d3 (250-383) |
Domain d1xmxa_: 1xmx A: [115568] Structural genomics target complexed with fmt, gol, mg |
PDB Entry: 1xmx (more details), 2.1 Å
SCOP Domain Sequences for d1xmxa_:
Sequence, based on SEQRES records: (download)
>d1xmxa_ c.52.1.26 (A:) Hypothetical protein VC1899 {Vibrio cholerae [TaxId: 666]} namaihvgiidqdpvrlvtplldhrtvsrhiifigdhtqtviyqrlsdvlnkrnistdff eipagsntsaiksairelaetlkargeevkfnascglrhrllsayevfrsyhwpifvvep nsdclcwlypegnndtqvqdritiadyltifgargefnehqlspqldqqlyqlgerwasn alelgpglatlnylattcrkeqkldvelsdkqqgyrelnlllsdlveakiasyengiltf ineearrfangewletlvhstvkqiqddmptiqdrslnvqvyrqlgerevrneldvatvv nnklhiiecktkgmrddgddtlykleslrdllgglqaramlvsfrplrhnditraedlgl aligpdelkdlkthltqwfkaaggn
>d1xmxa_ c.52.1.26 (A:) Hypothetical protein VC1899 {Vibrio cholerae [TaxId: 666]} namaihvgiidqdpvrlvtplldhrtvsrhiifigdhtqtviyqrlsdvlnkrnistdff eipagsntsaiksairelaetlkargeevkfnascglrhrllsayevfrsyhwpifvvep nsdclcwlypegnndtqvqdritiadyltifgargefnspqldqqlyqlgerwasnalel gpglatlnylattcrkeqkldvelsdkqqgyrelnlllsdlveakiasyengiltfinee arrfangewletlvhstvkqiqddmptiqdrslnvqvyrqlgerevrneldvatvvnnkl hiiecktkgmrdgddtlykleslrdllgglqaramlvsfrplrhnditraedlglaligp delkdlkthltqwfkaaggn
Timeline for d1xmxa_: