Lineage for d1xmxa1 (1xmx A:1-383)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2121131Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2121132Superfamily c.52.1: Restriction endonuclease-like [52980] (36 families) (S)
  5. 2121511Family c.52.1.26: Hypothetical protein VC1899 [117625] (1 protein)
    contains 2 extra N-terminal domains; d1: [alpha/beta; 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest; topological similarity to the Formyltransferase fold (53327)]; d2: [distorted "winged helix" fold (46785)]
    automatically mapped to Pfam PF09002
  6. 2121512Protein Hypothetical protein VC1899 [117626] (1 species)
  7. 2121513Species Vibrio cholerae [TaxId:666] [117627] (1 PDB entry)
    Uniprot Q9KQU9 # d1 (1-156); d2 (161-249); putative catalytic domain d3 (250-383)
  8. 2121514Domain d1xmxa1: 1xmx A:1-383 [115568]
    Other proteins in same PDB: d1xmxa2
    Structural genomics target
    complexed with fmt, gol, mg

Details for d1xmxa1

PDB Entry: 1xmx (more details), 2.1 Å

PDB Description: Crystal structure of protein VC1899 from Vibrio cholerae
PDB Compounds: (A:) hypothetical protein VC1899

SCOPe Domain Sequences for d1xmxa1:

Sequence, based on SEQRES records: (download)

>d1xmxa1 c.52.1.26 (A:1-383) Hypothetical protein VC1899 {Vibrio cholerae [TaxId: 666]}
maihvgiidqdpvrlvtplldhrtvsrhiifigdhtqtviyqrlsdvlnkrnistdffei
pagsntsaiksairelaetlkargeevkfnascglrhrllsayevfrsyhwpifvvepns
dclcwlypegnndtqvqdritiadyltifgargefnehqlspqldqqlyqlgerwasnal
elgpglatlnylattcrkeqkldvelsdkqqgyrelnlllsdlveakiasyengiltfin
eearrfangewletlvhstvkqiqddmptiqdrslnvqvyrqlgerevrneldvatvvnn
klhiiecktkgmrddgddtlykleslrdllgglqaramlvsfrplrhnditraedlglal
igpdelkdlkthltqwfkaaggn

Sequence, based on observed residues (ATOM records): (download)

>d1xmxa1 c.52.1.26 (A:1-383) Hypothetical protein VC1899 {Vibrio cholerae [TaxId: 666]}
maihvgiidqdpvrlvtplldhrtvsrhiifigdhtqtviyqrlsdvlnkrnistdffei
pagsntsaiksairelaetlkargeevkfnascglrhrllsayevfrsyhwpifvvepns
dclcwlypegnndtqvqdritiadyltifgargefnspqldqqlyqlgerwasnalelgp
glatlnylattcrkeqkldvelsdkqqgyrelnlllsdlveakiasyengiltfineear
rfangewletlvhstvkqiqddmptiqdrslnvqvyrqlgerevrneldvatvvnnklhi
iecktkgmrdgddtlykleslrdllgglqaramlvsfrplrhnditraedlglaligpde
lkdlkthltqwfkaaggn

SCOPe Domain Coordinates for d1xmxa1:

Click to download the PDB-style file with coordinates for d1xmxa1.
(The format of our PDB-style files is described here.)

Timeline for d1xmxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xmxa2