Lineage for d1wpna_ (1wpn A:)
- Root: SCOP 1.75
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.107: DHH phosphoesterases [64181] (1 superfamily)
consists of two non-similar domains
Domain 1 has parallel sheet of 6 strands, order 321456
Domain 2 has mixed sheet of 5 strands, order 12345; strands 1 & 4 are antiparallel to the restSuperfamily c.107.1: DHH phosphoesterases [64182] (2 families) 
constituent families have similar domain organization with variable interdomain linker and spatial arrangement of the domainsFamily c.107.1.1: Manganese-dependent inorganic pyrophosphatase (family II) [64183] (1 protein) Protein Manganese-dependent inorganic pyrophosphatase (family II) [64184] (3 species) Species Bacillus subtilis [TaxId:1423] [69610] (4 PDB entries)
Uniprot P37487
Domain d1wpna_: 1wpn A: [114826]
N-terminal core only
Details for d1wpna_
PDB Entry: 1wpn (more details), 1.3 Å
PDB Description: crystal structure of the n-terminal core of bacillus subtilis inorganic pyrophosphatase
PDB Compounds: (A:) Manganese-dependent inorganic pyrophosphataseSCOP Domain Sequences for d1wpna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wpna_ c.107.1.1 (A:) Manganese-dependent inorganic pyrophosphatase (family II) {Bacillus subtilis [TaxId: 1423]}
ekilifghqnpdtdticsaiayadlknklgfnaepvrlgqvngetqyaldyfkqesprlv
etaanevngvilvdhnerqqsikdieevqvlevidhhrianfetaeplyyraepvgctat
ilnkmykennvkiekeiaglmlsaiisdsllfksptctdqdvaaakelaeiagvdaeeyg
lnmlkag
SCOP Domain Coordinates for d1wpna_:
Click to download the PDB-style file with coordinates for d1wpna_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1wpna_:
- d1wpna_ first appeared in SCOP 1.71
- d1wpna_ appears in SCOP 1.73
- d1wpna_ appears in SCOPe 2.01
- d1wpna_ appears in the current release, SCOPe 2.08
View in 3D
