SCOP 1.73: Domain d1wpna_: 1wpn A:

Lineage for d1wpna_ (1wpn A:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.107: DHH phosphoesterases [64181] (1 superfamily)
   consists of two non-similar domains
   Domain 1 has parallel sheet of 6 strands, order 321456
   Domain 2 has mixed sheet of 5 strands, order 12345; strands 1 & 4 are antiparallel to the rest

4. Superfamily c.107.1: DHH phosphoesterases [64182] (2 families)
   constituent families have similar domain organization with variable interdomain linker and spatial arrangement of the domains

5. Family c.107.1.1: Manganese-dependent inorganic pyrophosphatase (family II) [64183] (1 protein)

6. Protein Manganese-dependent inorganic pyrophosphatase (family II) [64184] (3 species)

7. Species Bacillus subtilis [TaxId:1423] [69610] (4 PDB entries)

8. Domain d1wpna_: 1wpn A: [114826]

Details for d1wpna_

PDB Entry: 1wpn, 1.3 Å

PDB Description: crystal structure of the n-terminal core of bacillus subtilis inorganic pyrophosphatase

PDB Compounds: (A:) Manganese-dependent inorganic pyrophosphatase

SCOP Domain Sequences for d1wpna_:

Sequence; same for both SEQRES and ATOM records:

>d1wpna_ c.107.1.1 (A:) Manganese-dependent inorganic pyrophosphatase (family II) {Bacillus subtilis [TaxId: 1423]}
ekilifghqnpdtdticsaiayadlknklgfnaepvrlgqvngetqyaldyfkqesprlv
etaanevngvilvdhnerqqsikdieevqvlevidhhrianfetaeplyyraepvgctat
ilnkmykennvkiekeiaglmlsaiisdsllfksptctdqdvaaakelaeiagvdaeeyg
lnmlkag

Timeline for d1wpna_:

• d1wpna_ first appeared in SCOP 1.71
  
• d1wpna_ appears in SCOP 1.75
  
• d1wpna_ appears in the current release, SCOPe 2.08