Lineage for d1wjpa3 (1wjp A:67-107)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 892092Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
    simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC
  4. 892093Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (7 families) (S)
  5. 892094Family g.37.1.1: Classic zinc finger, C2H2 [57668] (30 proteins)
  6. 892286Protein Zinc finger protein 295, ZNF295 [118267] (1 species)
  7. 892287Species Human (Homo sapiens) [TaxId:9606] [118268] (1 PDB entry)
    Uniprot Q9ULJ3 713-806
  8. 892290Domain d1wjpa3: 1wjp A:67-107 [114707]
    Structural genomics target
    complexed with zn

Details for d1wjpa3

PDB Entry: 1wjp (more details)

PDB Description: solution structure of zf-c2h2 domains from human zinc finger protein 295
PDB Compounds: (A:) Zinc finger protein 295

SCOP Domain Sequences for d1wjpa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wjpa3 g.37.1.1 (A:67-107) Zinc finger protein 295, ZNF295 {Human (Homo sapiens) [TaxId: 9606]}
ykkltclecmrtfkssfsiwrhqvevhnqnnmaptsgpssg

SCOP Domain Coordinates for d1wjpa3:

Click to download the PDB-style file with coordinates for d1wjpa3.
(The format of our PDB-style files is described here.)

Timeline for d1wjpa3: