Lineage for d1vpda1 (1vpd A:164-296)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 773947Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 773948Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (12 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 773949Family a.100.1.1: Hydroxyisobutyrate and 6-phosphogluconate dehydrogenase domain [48180] (2 proteins)
    Hydroxyisobutyrate dehydrogenase domain is similar to one structural repeat in the 6-phosphogluconate dehydrogenase domain
  6. 773960Protein Hydroxyisobutyrate dehydrogenase [101357] (3 species)
    forms similar dimeric and tetrameric structures to the 6-phosphogluconate dehydrogenase domain and its dimer, respectively
  7. 773963Species Salmonella typhimurium [TaxId:90371] [109948] (1 PDB entry)
    Uniprot Q8ZLV8
  8. 773964Domain d1vpda1: 1vpd A:164-296 [113951]
    Other proteins in same PDB: d1vpda2
    Structural genomics target
    complexed with cl, tla

Details for d1vpda1

PDB Entry: 1vpd (more details), 1.65 Å

PDB Description: X-Ray Crystal Structure of Tartronate Semialdehyde Reductase [Salmonella Typhimurium LT2]
PDB Compounds: (A:) tartronate semialdehyde reductase

SCOP Domain Sequences for d1vpda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vpda1 a.100.1.1 (A:164-296) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]}
digagnvtklanqvivalniaamsealtlatkagvnpdlvyqairgglagstvldakapm
vmdrnfkpgfridlhikdlanaldtshgvgaqlpltaavmemmqalradghgnddhsala
cyyeklakvevtr

SCOP Domain Coordinates for d1vpda1:

Click to download the PDB-style file with coordinates for d1vpda1.
(The format of our PDB-style files is described here.)

Timeline for d1vpda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vpda2