PDB entry 1vpd

View 1vpd on RCSB PDB site
Description: X-Ray Crystal Structure of Tartronate Semialdehyde Reductase [Salmonella Typhimurium LT2]
Class: oxidoreductase
Keywords: STRUCTURAL GENOMICS, MCSG, PROTEIN STRUCTURE INITIATIVE, REDUCTASE, TARTRONATE, PSI, Midwest Center for Structural Genomics
Deposited on 2004-10-22, released 2004-10-26
The last revision prior to the SCOP 1.75 freeze date was dated 2006-10-24, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.121
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tartronate semialdehyde reductase
    Species: Salmonella typhimurium
    Gene: GARR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZLV8 (Start-298)
      • modified residue (5)
      • modified residue (15)
      • modified residue (19)
      • modified residue (67)
      • modified residue (97)
      • modified residue (119)
      • modified residue (139)
      • modified residue (154)
      • modified residue (157)
      • modified residue (188)
      • modified residue (225)
      • modified residue (227)
      • modified residue (265)
      • modified residue (267-268)
    Domains in SCOP 1.75: d1vpda1, d1vpda2
  • Heterogens: CL, TLA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vpdA (A:)
    snamtmkvgfiglgimgkpmsknllkagyslvvsdrnpeaiadviaagaetastakaiae
    qcdviitmlpnsphvkevalgengiiegakpgtvlidmssiaplasreisdalkakgvem
    ldapvsggepkaidgtlsvmvggdkaifdkyydlmkamagsvvhtgdigagnvtklanqv
    ivalniaamsealtlatkagvnpdlvyqairgglagstvldakapmvmdrnfkpgfridl
    hikdlanaldtshgvgaqlpltaavmemmqalradghgnddhsalacyyeklakvevtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vpdA (A:)
    mkvgfiglgimgkpmsknllkagyslvvsdrnpeaiadviaagaetastakaiaeqcdvi
    itmlpnsphvkevalgengiiegakpgtvlidmssiaplasreisdalkakgvemldapv
    sggepkaidgtlsvmvggdkaifdkyydlmkamagsvvhtgdigagnvtklanqvivaln
    iaamsealtlatkagvnpdlvyqairgglagstvldakapmvmdrnfkpgfridlhikdl
    analdtshgvgaqlpltaavmemmqalradghgnddhsalacyyeklakvevtr