Lineage for d1u6ma_ (1u6m A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 870001Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 870002Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (10 families) (S)
  5. 870003Family d.108.1.1: N-acetyl transferase, NAT [55730] (57 proteins)
  6. 870297Protein Putative acetyltransferase EF0945 [118070] (1 species)
  7. 870298Species Enterococcus faecalis [TaxId:1351] [118071] (1 PDB entry)
    Uniprot Q836Z8
  8. 870299Domain d1u6ma_: 1u6m A: [113069]
    Structural genomics target

Details for d1u6ma_

PDB Entry: 1u6m (more details), 2.4 Å

PDB Description: the crystal structure of acetyltransferase
PDB Compounds: (A:) acetyltransferase, GNAT family

SCOP Domain Sequences for d1u6ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u6ma_ d.108.1.1 (A:) Putative acetyltransferase EF0945 {Enterococcus faecalis [TaxId: 1351]}
slirsatkedgqaiarlvlvilkdmelpileevseeqmidllaeatayptyrygyqrilv
yehagevagiavgypaedekiideplrevfkkhglaedvrlfieeetlpnewyldtisvd
erfrgmgigsklldalpevakasgkqalglnvdfdnpgarklyaskgfkdvttmtisghl
ynhmqkeve

SCOP Domain Coordinates for d1u6ma_:

Click to download the PDB-style file with coordinates for d1u6ma_.
(The format of our PDB-style files is described here.)

Timeline for d1u6ma_: