Lineage for d1ob8a_ (1ob8 A:)
- Root: SCOP 1.75
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the restSuperfamily c.52.1: Restriction endonuclease-like [52980] (33 families) 
Family c.52.1.18: Hjc-like [64080] (2 proteins)
Pfam PF01870Protein Holliday-junction resolvase SSO1176 [117617] (1 species) Species Sulfolobus solfataricus [TaxId:2287] [117618] (2 PDB entries)
Uniprot Q97YX6
Domain d1ob8a_: 1ob8 A: [111627]
Details for d1ob8a_
PDB Entry: 1ob8 (more details), 1.8 Å
PDB Description: holliday junction resolving enzyme
PDB Compounds: (A:) holliday-junction resolvaseSCOP Domain Sequences for d1ob8a_:
Sequence, based on SEQRES records: (download)
>d1ob8a_ c.52.1.18 (A:) Holliday-junction resolvase SSO1176 {Sulfolobus solfataricus [TaxId: 2287]}
gknaerelvsilrgegfnavriptsnsspnplpdifatkgntllsieckstwenkvkvke
hqvrklldflsmftmkgvpliaikfkqvhewrvlvpekaediivtidnsipiedlfkile
krie
Sequence, based on observed residues (ATOM records): (download)
>d1ob8a_ c.52.1.18 (A:) Holliday-junction resolvase SSO1176 {Sulfolobus solfataricus [TaxId: 2287]}
gknaerelvsilrgegfnavriptnplpdifatkgntllsieckstwenkvkvkehqvrk
lldflsmftmkgvpliaikfkqvhewrvlvpekaediivtidnsipiedlfkilekrie
SCOP Domain Coordinates for d1ob8a_:
Click to download the PDB-style file with coordinates for d1ob8a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ob8a_:
- d1ob8a_ first appeared in SCOP 1.71
- d1ob8a_ appears in SCOP 1.73
- d1ob8a_ appears in SCOPe 2.01
- d1ob8a_ appears in the current release, SCOPe 2.08
View in 3D
