Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) |
Family c.52.1.18: Hjc-like [64080] (3 proteins) Pfam PF01870 |
Protein Holliday-junction resolvase SSO1176 [117617] (1 species) |
Species Sulfolobus solfataricus [TaxId:2287] [117618] (2 PDB entries) Uniprot Q97YX6 |
Domain d1ob8a_: 1ob8 A: [111627] complexed with edo, so4 |
PDB Entry: 1ob8 (more details), 1.8 Å
SCOPe Domain Sequences for d1ob8a_:
Sequence, based on SEQRES records: (download)
>d1ob8a_ c.52.1.18 (A:) Holliday-junction resolvase SSO1176 {Sulfolobus solfataricus [TaxId: 2287]} gknaerelvsilrgegfnavriptsnsspnplpdifatkgntllsieckstwenkvkvke hqvrklldflsmftmkgvpliaikfkqvhewrvlvpekaediivtidnsipiedlfkile krie
>d1ob8a_ c.52.1.18 (A:) Holliday-junction resolvase SSO1176 {Sulfolobus solfataricus [TaxId: 2287]} gknaerelvsilrgegfnavriptnplpdifatkgntllsieckstwenkvkvkehqvrk lldflsmftmkgvpliaikfkqvhewrvlvpekaediivtidnsipiedlfkilekrie
Timeline for d1ob8a_: