Lineage for d1vl0a_ (1vl0 A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 819418Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 819419Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 819736Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (70 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 820111Protein DTDP-4-dehydrorhamnose reductase RfbD [110409] (1 species)
  7. 820112Species Clostridium acetobutylicum [TaxId:1488] [110410] (1 PDB entry)
    Uniprot Q97GQ1
  8. 820113Domain d1vl0a_: 1vl0 A: [108704]
    Structural genomics target

Details for d1vl0a_

PDB Entry: 1vl0 (more details), 2.05 Å

PDB Description: crystal structure of a dtdp-4-dehydrorhamnose reductase, rfbd ortholog (ca_c2315) from clostridium acetobutylicum atcc 824 at 2.05 a resolution
PDB Compounds: (A:) DTDP-4-dehydrorhamnose reductase, rfbD ortholog

SCOP Domain Sequences for d1vl0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]}
hmkilitgangqlgreiqkqlkgknveviptdvqdlditnvlavnkffnekkpnvvinca
ahtavdkceeqydlaykinaigpknlaaaaysvgaeivqistdyvfdgeakepitefdev
npqsaygktklegenfvkalnpkyyivrtawlygdgnnfvktminlgkthdelkvvhdqv
gtptstvdlarvvlkvideknygtfhctckgicswydfaveifrltgidvkvtpctteef
prpakrpkysvlrnymlelttgditrewkeslkeyidllqm

SCOP Domain Coordinates for d1vl0a_:

Click to download the PDB-style file with coordinates for d1vl0a_.
(The format of our PDB-style files is described here.)

Timeline for d1vl0a_: