Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.8: Rbstp2229 protein [111171] (1 family) forms segment-swapped dimers further organized in hexamers |
Family d.129.8.1: Rbstp2229 protein [111172] (1 protein) |
Protein Rbstp2229 protein [111173] (1 species) |
Species Bacillus stearothermophilus [TaxId:1422] [111174] (1 PDB entry) Uniprot P84137 |
Domain d1t6aa_: 1t6a A: [106555] complexed with no3 |
PDB Entry: 1t6a (more details), 2.05 Å
SCOP Domain Sequences for d1t6aa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t6aa_ d.129.8.1 (A:) Rbstp2229 protein {Bacillus stearothermophilus [TaxId: 1422]} amntdlklpagktmtiedvkqlleryqmalkktgeqlgwayeqaafpytvrihesvlylq gdgrlykgmaisvrtageetfidialppgathgdkgkanefskwlaktlggelhlfsgrt mvfg
Timeline for d1t6aa_: