Lineage for d1t6aa_ (1t6a A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538746Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2539628Superfamily d.129.8: Rbstp2229 protein [111171] (1 family) (S)
    forms segment-swapped dimers further organized in hexamers
    automatically mapped to Pfam PF08968
  5. 2539629Family d.129.8.1: Rbstp2229 protein [111172] (1 protein)
  6. 2539630Protein Rbstp2229 protein [111173] (1 species)
  7. 2539631Species Bacillus stearothermophilus [TaxId:1422] [111174] (1 PDB entry)
    Uniprot P84137
  8. 2539632Domain d1t6aa_: 1t6a A: [106555]
    complexed with no3

Details for d1t6aa_

PDB Entry: 1t6a (more details), 2.05 Å

PDB Description: Crystal Structure of Protein of Unknown Function from Bacillus stearothermophilus
PDB Compounds: (A:) RBSTP2229 gene product

SCOPe Domain Sequences for d1t6aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t6aa_ d.129.8.1 (A:) Rbstp2229 protein {Bacillus stearothermophilus [TaxId: 1422]}
amntdlklpagktmtiedvkqlleryqmalkktgeqlgwayeqaafpytvrihesvlylq
gdgrlykgmaisvrtageetfidialppgathgdkgkanefskwlaktlggelhlfsgrt
mvfg

SCOPe Domain Coordinates for d1t6aa_:

Click to download the PDB-style file with coordinates for d1t6aa_.
(The format of our PDB-style files is described here.)

Timeline for d1t6aa_: