Lineage for d1t3ka_ (1t3k A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 833370Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451
  4. 833371Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (4 families) (S)
    Pfam PF00581
    the active site structure is similar to those of the families I and II protein phosphatases; the topology can be related by a different circular permutation to the family I topology
  5. 833372Family c.46.1.1: Cell cycle control phosphatase, catalytic domain [52822] (4 proteins)
  6. 833393Protein Dual specificity phosphatase Cdc25 [110598] (1 species)
  7. 833394Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [110599] (1 PDB entry)
    Uniprot Q8GY31
  8. 833395Domain d1t3ka_: 1t3k A: [106357]
    complexed with zn; mutant

Details for d1t3ka_

PDB Entry: 1t3k (more details)

PDB Description: nmr structure of a cdc25-like dual-specificity tyrosine phosphatase of arabidopsis thaliana
PDB Compounds: (A:) Dual-specificity tyrosine phosphatase

SCOP Domain Sequences for d1t3ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t3ka_ c.46.1.1 (A:) Dual specificity phosphatase Cdc25 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
mamarsisyitstqllplhrrpniaiidvrdeernydghiagslhyasgsfddkishlvq
nvkdkdtlvfhsalsqvrgptcarrlvnyldekkedtgiknimilergfngweasgkpvc
rcaevpckgdca

SCOP Domain Coordinates for d1t3ka_:

Click to download the PDB-style file with coordinates for d1t3ka_.
(The format of our PDB-style files is described here.)

Timeline for d1t3ka_: