![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451 |
![]() | Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (5 families) ![]() Pfam PF00581 the active site structure is similar to those of the families I and II protein phosphatases; the topology can be related by a different circular permutation to the family I topology |
![]() | Family c.46.1.1: Cell cycle control phosphatase, catalytic domain [52822] (5 proteins) |
![]() | Protein Dual specificity phosphatase Cdc25 [110598] (1 species) |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [110599] (1 PDB entry) Uniprot Q8GY31 |
![]() | Domain d1t3ka_: 1t3k A: [106357] complexed with zn |
PDB Entry: 1t3k (more details)
SCOPe Domain Sequences for d1t3ka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t3ka_ c.46.1.1 (A:) Dual specificity phosphatase Cdc25 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} mamarsisyitstqllplhrrpniaiidvrdeernydghiagslhyasgsfddkishlvq nvkdkdtlvfhsalsqvrgptcarrlvnyldekkedtgiknimilergfngweasgkpvc rcaevpckgdca
Timeline for d1t3ka_: