Lineage for d1t16a_ (1t16 A:)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 886206Fold f.4: Transmembrane beta-barrels [56924] (6 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
  4. 886252Superfamily f.4.3: Porins [56935] (4 families) (S)
  5. 886372Family f.4.3.4: Outer membrane protein transport protein [111361] (1 protein)
    Pfam PF03349; monomeric (14,16) barrel; plugged by an N-terminal all-alpha subdomain (1-40)
  6. 886373Protein Long-chain fatty acid transport protein FadL [111362] (1 species)
  7. 886374Species Escherichia coli [TaxId:562] [111363] (2 PDB entries)
    Uniprot P10384
  8. 886375Domain d1t16a_: 1t16 A: [106242]

Details for d1t16a_

PDB Entry: 1t16 (more details), 2.6 Å

PDB Description: Crystal structure of the bacterial fatty acid transporter FadL from Escherichia coli
PDB Compounds: (A:) Long-chain fatty acid transport protein

SCOP Domain Sequences for d1t16a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t16a_ f.4.3.4 (A:) Long-chain fatty acid transport protein FadL {Escherichia coli [TaxId: 562]}
agfqlnefsssglgraysgegaiaddagnvsrnpalitmfdrptfsagavyidpdvnisg
tspsgrslkadniaptawvpnmhfvapindqfgwgasitsnyglatefndtyaggsvggt
tdletmnlnlsgayrlnnawsfglgfnavyarakierfagdlgqlvagqimqspagqtqq
gqalaatangidsntkiahlngnqwgfgwnagilyeldknnryaltyrsevkidfkgnys
sdlnrafnnyglpiptatggatqsgyltlnlpemwevsgynrvdpqwaihyslaytswsq
fqqlkatstsgdtlfqkhegfkdayrialgttyyyddnwtfrtgiafddspvpaqnrsis
ipdqdrfwlsagttyafnkdasvdvgvsymhgqsvkinegpyqfesegkawlfgtnfnya
fhhhhhh

SCOP Domain Coordinates for d1t16a_:

Click to download the PDB-style file with coordinates for d1t16a_.
(The format of our PDB-style files is described here.)

Timeline for d1t16a_: