Lineage for d1t16a1 (1t16 A:1-421)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3021955Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3022096Superfamily f.4.3: Porins [56935] (5 families) (S)
  5. 3022343Family f.4.3.4: Outer membrane protein transport protein [111361] (2 proteins)
    Pfam PF03349; monomeric (14,16) barrel; plugged by an N-terminal all-alpha subdomain (1-40)
  6. 3022344Protein Long-chain fatty acid transport protein FadL [111362] (1 species)
  7. 3022345Species Escherichia coli [TaxId:562] [111363] (2 PDB entries)
    Uniprot P10384
  8. 3022346Domain d1t16a1: 1t16 A:1-421 [106242]
    Other proteins in same PDB: d1t16a2, d1t16b2
    complexed with c8e, cu, lda

Details for d1t16a1

PDB Entry: 1t16 (more details), 2.6 Å

PDB Description: Crystal structure of the bacterial fatty acid transporter FadL from Escherichia coli
PDB Compounds: (A:) Long-chain fatty acid transport protein

SCOPe Domain Sequences for d1t16a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t16a1 f.4.3.4 (A:1-421) Long-chain fatty acid transport protein FadL {Escherichia coli [TaxId: 562]}
agfqlnefsssglgraysgegaiaddagnvsrnpalitmfdrptfsagavyidpdvnisg
tspsgrslkadniaptawvpnmhfvapindqfgwgasitsnyglatefndtyaggsvggt
tdletmnlnlsgayrlnnawsfglgfnavyarakierfagdlgqlvagqimqspagqtqq
gqalaatangidsntkiahlngnqwgfgwnagilyeldknnryaltyrsevkidfkgnys
sdlnrafnnyglpiptatggatqsgyltlnlpemwevsgynrvdpqwaihyslaytswsq
fqqlkatstsgdtlfqkhegfkdayrialgttyyyddnwtfrtgiafddspvpaqnrsis
ipdqdrfwlsagttyafnkdasvdvgvsymhgqsvkinegpyqfesegkawlfgtnfnya
f

SCOPe Domain Coordinates for d1t16a1:

Click to download the PDB-style file with coordinates for d1t16a1.
(The format of our PDB-style files is described here.)

Timeline for d1t16a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t16a2